PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G077800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 806aa    MW: 86298.3 Da    PI: 5.093
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G077800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.34.8e-2299154156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe+lF+++++p++++r eL+++lgL+ rqVk+WFqNrR+++k
  Sevir.5G077800.1.p  99 KKRYHRHTPQQIQELEALFKECPHPDEKQRGELSRRLGLDPRQVKFWFQNRRTQMK 154
                         678899***********************************************999 PP

2START189.91.3e-593155471206
                         HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCS.CHHHHHHHHHCCCGGCT-TT-S.. CS
               START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvd.mvlallveellddkeqWdetla.. 77 
                         ela +a++elvk+a+ +ep+W  s       e++n +e+ q+f +  +     + +ea+r+sg+v+ ++++ lve+l+d + +W+ ++   
  Sevir.5G077800.1.p 315 ELAISAMDELVKLAQIDEPLWLPSLngspnkEMLNFEEYAQSFLPCIGvkpvgYVSEASRESGLVIiDDSVALVETLMDER-RWSDMFScm 404
                         57889********************999999999*********998889**************997245679*********.********* PP

                         ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE..-TTS--....-TTSEE-EESSEEEEE CS
               START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd..seqkppe...sssvvRaellpSgili 154
                           ka++le ++sg      g l lm+aelq+lsplvp R+++f+R+++ql +g w++vdvS+d  ++++++    +++ vR+++lpSg+++
  Sevir.5G077800.1.p 405 iaKATILEEVTSGiagsrnGMLLLMKAELQVLSPLVPiREVTFLRFCKQLAEGAWAVVDVSIDglVRDQNSAtisNAGNVRCRRLPSGCVM 495
                         *9************************************************************95433444446899*************** PP

                         EEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 155 epksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         ++++ng++kvtwveh++++++++h+l+r+l++sgla+ga++w+a lqrqce+
  Sevir.5G077800.1.p 496 QDTPNGYCKVTWVEHTEYDEASVHQLYRPLLRSGLAFGARRWLAMLQRQCEC 547
                         **************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.52E-2280156IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-2484156IPR009057Homeodomain-like
PROSITE profilePS5007118.28596156IPR001356Homeobox domain
SMARTSM003894.8E-2197160IPR001356Homeobox domain
CDDcd000866.81E-2098156No hitNo description
PfamPF000461.5E-1999154IPR001356Homeobox domain
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PROSITE profilePS5084847.171306550IPR002913START domain
SuperFamilySSF559611.54E-31308547No hitNo description
CDDcd088751.14E-114310546No hitNo description
SMARTSM002341.7E-48315547IPR002913START domain
PfamPF018525.1E-52316547IPR002913START domain
SuperFamilySSF559618.79E-22567775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 806 aa     Download sequence    Send to blast
MSFGSLFDGG AGGGGGGGMQ FPFSGGFSSS PALSLGLDNA GGGGGMGGGR ALPGGAGDGS  60
ARDADAENDS RSGSDHLDAM SGGGEDEDDA EPGNPRKRKK RYHRHTPQQI QELEALFKEC  120
PHPDEKQRGE LSRRLGLDPR QVKFWFQNRR TQMKTQLERH ENALLKQEND KLRAENMTIR  180
EAMRTPMCGS CGSPAMLGEV SLEEQHLCIE NARLKDELNR VYALATKFLG KPMAMLSGPM  240
LQPHLSSLPM PSSSLELAVG GFRGLGSIPS ATMPGSMSEF AGGVSSPLGT VITPARATGS  300
APPSMVGIDR SMLLELAISA MDELVKLAQI DEPLWLPSLN GSPNKEMLNF EEYAQSFLPC  360
IGVKPVGYVS EASRESGLVI IDDSVALVET LMDERRWSDM FSCMIAKATI LEEVTSGIAG  420
SRNGMLLLMK AELQVLSPLV PIREVTFLRF CKQLAEGAWA VVDVSIDGLV RDQNSATISN  480
AGNVRCRRLP SGCVMQDTPN GYCKVTWVEH TEYDEASVHQ LYRPLLRSGL AFGARRWLAM  540
LQRQCECLAI LMSPDTVSAN DSSVITQEGK RSMLKLARRM TENFCAGVSA SSAREWSKLD  600
GATGSIGEDV RVMARKSVDE PGEPPGVVLS AATSVWVPVA PEKLFNFLRD EQLRAEWDIL  660
SNGGPMQEMA NIAKGQEHGN SVSLLRASAM SANQSSMLIL QETCTDASGS MVVYAPVDIP  720
AMQLVMNGGD STYVALLPSG FAILPDGPST GADHKTGGSL LTVAFQILVN SQPTAKLTVE  780
SVETVNNLIS CTIKKIKTAL QWDSA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194100PRKRKKR
29599RKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0632490.0BT063249.1 Zea mays full-length cDNA clone ZM_BFc0042P14 mRNA, complete cds.
GenBankBT0644530.0BT064453.1 Zea mays full-length cDNA clone ZM_BFc0170E20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968002.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like isoform X2
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLK3XEN00.0K3XEN0_SETIT; Uncharacterized protein
STRINGSi000344m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1